DPCstruct | MC11219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 118 ± 18 aa |
| Standard deviation of domain lengths | 18.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04203 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5Y868 | 13-155 | IVNIIYTIIIIVLVLALGFSIYKIINWDKDNKRVKEQEEEIKKITDIVEVDETDNKNIEVIEQKEEIAKENPYWDFIKIPLISVNFD… |
| A8RNL4 | 2-115 | LVVSLFMLGHSLLGLEKSQVVFTTLTTRVEEERKRPKPTTTIELVTEDTHASSPYAVLKEENGNLFGWVKIAGTKLDYPVMYTPEEP… |
| A0A1Q6KD09 | 1-101 | None |
| A0A6N2UDD3 | 290-386 | None |
| A0A6N7J2F4 | 152-286 | None |
| A0A7X6XBY1 | 148-278 | None |
| K9B8N1 | 2-107 | None |
| A0A414JBB2 | 2-93 | None |
| A0A847C9V1 | 36-128 | None |
| A0A1H0C2N8 | 486-594 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.