DPCstruct | MC11218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 150 ± 21 aa |
| Standard deviation of domain lengths | 21.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03611 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1LIY7 | 2-114 | GGMFGFLGSTVGCIIVTFLTIIFHSPVIVFPSPIIMYFDGNVMGVFGNKAGGWRGAIAAGLITGLISSAAVILFYPLTGAVYGSGLT… |
| U2QFA0 | 25-174 | MFVSELTVSFQGISNKILPGSLPAVDCAASYGFGSPSAVLFGFLVGTIAQFISIAGLLIFKSPVFIITGFVPVFFDNATIAVYADKR… |
| A0A6D2G575 | 183-358 | None |
| A0A852TJ29 | 92-247 | None |
| A0A847VT54 | 257-437 | None |
| S4CXD8 | 41-193 | None |
| A0A828ZLU8 | 124-314 | None |
| A0A488BRP6 | 235-392 | None |
| A0A381KLR1 | 23-142 | None |
| A0A7I6IR79 | 2-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.