DPCstruct | MC11214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.91 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF05929- CL0373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A607GY60 | 7-81 | ISYAQLDAWNSQPDFAARISKQIALQIALDRIMIGFNGTSHALVSDFAANPRLQDVNTGWLEHIRKQATARVMKG |
| A0A2S8JMH8 | 2-90 | SLVSRGYRCEQVNFDFALNYDNVDAHASANGLEGSARAAFERRKWLDLIQIGFNGTHYADTSDPGTYPGRDDCGVGWLQKFRNEAAG… |
| A0A379KEC6 | 16-113 | None |
| A0A193QLS6 | 13-126 | None |
| A0A3P2EHL7 | 15-126 | None |
| A0A376ZJL7 | 17-131 | None |
| A0A1W9F793 | 87-213 | None |
| A0A2X2BSD7 | 1-74 | None |
| A0A381GKB3 | 87-188 | None |
| A0A377CXC6 | 93-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.