DPCstruct | MC11212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 14.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6MXI5 | 95-187 | KKAHKPDDDGYFNIIEVLIHLDGIIIEQCGSWLWLSGKTKEHTKALKDAGCRLARKKKMWYWRPADAACNNRRKRGYRSMAYIRKKY… |
| A0A2H4UEB6 | 1-92 | MENVLRELAGLTDIVFEIIGNWVWISGDTKTHKDTLKALKCRWASKKQQWFYRPEEHKSRRSFGEMSIDEIREKFGSFGKRKSSGRK… |
| G2JBC1 | 19-103 | None |
| R6WLL6 | 222-310 | None |
| A0A7T9W2Q4 | 71-156 | None |
| A0A1M4VCT6 | 37-173 | None |
| A0A2N5YWM8 | 28-111 | None |
| A0A395U2B6 | 73-161 | None |
| A0A1E3G621 | 91-189 | None |
| A0A847WLQ6 | 103-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.