DPCstruct | MC11210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3TG57 | 8-112 | SVDIARAIDHDASVELWGRYQRGERDVFTRRLYTLKGQQTFDEIKRKYERETEFRTAVDRYISDFEKLLADVARTDRDRTVTQSYLT… |
| A0A4Q0SDA3 | 1-98 | MDRNLAAEMWDRYQRGENKAFTKRLYTPAGQKAFDEVARKYRTDRNFKATVDRYVAEFERLLDEVARDGRGPQELRSHLTSETGLVY… |
| A0A8B6M254 | 215-342 | None |
| A0A397Q7U7 | 1087-1189 | None |
| A0A1I6R766 | 615-751 | None |
| A0A849THF6 | 54-155 | None |
| A0A3D3B161 | 118-222 | None |
| A0A836X367 | 265-380 | None |
| A0A7L5Y215 | 27-135 | None |
| A0A2E9B793 | 729-844 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.