DPCstruct | MC1121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y8BJW2 | 4-96 | ELFITRLAFINNDEINKINKNSSTVYLKALYQCENSIAVNYDEEELFTQTTAINNLGYSNDFTKIFILDKESLNDTYLDARKKLYKS… |
| A0A4V6HY62 | 1-96 | MQTHLFSRRPIVLSMQDIDSLTKDSPIALLNALYQCQDFVFVDSMHNPSLNESNITKTFGYKSSFYLSFIANKDSLSNEYLQARKAL… |
| A0A809N8P0 | 585-673 | None |
| A0A809NA57 | 200-334 | None |
| A0A4V7IEG1 | 205-310 | None |
| A0A7M1CZ84 | 8-102 | None |
| A0A824D4D0 | 77-171 | None |
| T1DVJ6 | 538-641 | None |
| A0A4V7IEH3 | 10-102 | None |
| A0A5T1S2R0 | 200-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.