DPCstruct | MC11209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 373 ± 31 aa |
| Standard deviation of domain lengths | 31.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284R925 | 29-360 | MQTNAYHLLLMCTEDLLEQLYGGKGSEYLLYGTSRNISNVPAVVRHLFIARILKTICLLGYNIRNDLIQNKIRKLLLSLRHEGCMLP… |
| A0A067MP10 | 2-423 | ITVLERRLSREKVDADYANGFIRALGQLFKDLPNYPKRPARHHDEDEDDEQDQGEGLHEKFISGVIRKTQGFRILRIIAFFVENDRS… |
| A0A4Q9PHX6 | 578-976 | None |
| S7RTY5 | 54-457 | None |
| A0A4Q2CYI0 | 11-350 | None |
| A0A2G8S866 | 1-352 | None |
| B8P021 | 173-525 | None |
| M5CBH6 | 105-517 | None |
| A0A0W0G8X0 | 757-1104 | None |
| A0A0K6GD00 | 244-612 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.