DPCstruct | MC11207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 255 ± 27 aa |
| Standard deviation of domain lengths | 27.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7MH30 | 69-304 | DTMLQELLYRCRDSSRPIPDKSTLLETCLTAVLPICNDTVDIKQHLTAFVNGCTVENESHAHFARAANTALLRMNSLEVSGLPSSRD… |
| A0A067MG42 | 1-303 | MPTLCSRPLRPQASKPGHSHGIRTLYHIRVCSATSTTRYALSALDSLAAPLPSEPYLEPWIREDISTHRLFTFEALLVGLLRHRFPS… |
| A0A0D0DCC3 | 2-228 | None |
| A0A0K6FR14 | 9-250 | None |
| A0A4R0R293 | 566-816 | None |
| A0A2R6NPZ3 | 11-254 | None |
| A0A2R6P091 | 25-286 | None |
| A0A0W0GCR0 | 12-283 | None |
| A0A067N7T6 | 69-304 | None |
| A0A165KND8 | 23-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.