DPCstruct | MC11204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 157 ± 24 aa |
| Standard deviation of domain lengths | 24.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0V1I1 | 7-143 | LPFWPAIVFVYFESTSILIGVYLASSTPADFISRQLPVPPTHPLPPHALIVSASIANMFLVQCMLSLLFTVVTRESKLTKYYLAAAS… |
| A0A067M592 | 6-165 | PALPGFYSLLFLHFEPISTFTAAVTIWFYPGTSWYFHELIPSPTVQAPETVLDARSQQALWHVANCYFLLGLISSFGFRAIRKTLRD… |
| A0A5C6SX55 | 353-499 | None |
| G3J9R3 | 5-153 | None |
| T5ALE1 | 1-142 | None |
| A0A2I0S0K1 | 1-136 | None |
| A0A6A5QH25 | 84-235 | None |
| W2RT89 | 6-168 | None |
| A0A5C3LJC6 | 1-168 | None |
| A0A0F9WWS9 | 178-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.