DPCstruct | MC11203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3QZF7 | 1-110 | MDPDKDLLVLMEKPPKKTATAPNPPLAVHLLALRDPDANPHPLAEHPILYYQPPIWNRKYHYWVQVVGDVLAVMFIPEVRQQDEAIA… |
| A0A1J8PIT6 | 290-393 | GFDIRDFTIDTSQDLIVAVEQVGVYPNHSCKIHLRTLSTGEHHPMSVVPFVTHVPLSMHEEFKFLIQTCGSRIAVLLQQLVDDSSSD… |
| A0A4S4LEX0 | 139-242 | None |
| A0A4Y9ZRM8 | 117-239 | None |
| A0A4Y9YX91 | 137-270 | None |
| A0A4Y9YKQ2 | 150-250 | None |
| S7Q7F7 | 58-167 | None |
| X8IX12 | 179-275 | None |
| A0A5B1R7N7 | 189-292 | None |
| A0A0C3S1U3 | 110-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.