DPCstruct | MC11202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 284 ± 15 aa |
| Standard deviation of domain lengths | 15.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 48.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2T5H0 | 80-371 | IYIKLCNCKMFNKAFVDKFTTDKSKATMKDFMSTQGFITRYKYSYSDYAQEMQRLKSFLDGKRDFLGYIQAIGYWKEEIENDILPNK… |
| I9VUX1 | 1-304 | MRVNGTIYAKLCKGLGKPFVNKFLNPKSEAPMKGFMPSKEFVKRYRYTSKDNMERTRQLKSFLNFKRDFLGYIEVVGYWKESLKDGL… |
| A0A496IYZ8 | 56-320 | None |
| A0A2T6UCW5 | 1-252 | None |
| A0A1A9H452 | 43-331 | None |
| T0F3G6 | 30-315 | None |
| M7RX44 | 186-471 | None |
| A0A7K1MTX9 | 67-364 | None |
| A0A2A6Z184 | 1-295 | None |
| I9ZP31 | 1-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.