DPCstruct | MC11200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 107 ± 23 aa |
| Standard deviation of domain lengths | 23.34 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X5MIE5 | 1-94 | MNNLKNMNLDELQEMRIQIDAELKKRQVKEKQNARRKILEIANAHGIDIADLVRKERHYRNPNNQWELWNGRGRKPKWIKEWLENGY… |
| A0A5C1Q3E4 | 7-119 | LRAKQEELRKQQEEIARSIEEFRSSQRAGVIAEIKAMMAQHGLTVSDLETPAGRGSRAAAEGKTREPSKVAIKYRDAETGSTWTGRG… |
| A0A370NAY0 | 2-94 | None |
| A0A228IIC2 | 3-108 | None |
| A0A4R7QIF9 | 1-113 | None |
| A0A8A8VJL2 | 3-139 | None |
| A0A1X7AQE7 | 3-137 | None |
| A0A355YG01 | 8-128 | None |
| A0A4R1PGF5 | 23-107 | None |
| A0A6L3MNE9 | 2-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.