DPCstruct | MC1120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.16 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 60.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W6BVI0 | 2-76 | SETYEIYMPNGIILDVEKETNKILLDDRGAKVGKYTQEYSKALFEADRILRNSPYINYQPQYLDPNLNTGQRSTL |
| A0A825DWM2 | 1-67 | MSGNKDIYEIYTSNGLILEVDKNTNQIIFDKRKDGREVGKYTQEYSKALFEADRILRTSPYINYQPR |
| A0A851HBJ8 | 5-72 | None |
| A0A824DNH3 | 1-70 | None |
| A0A7U7ZCP7 | 1-70 | None |
| A0A7U7VAV1 | 2-62 | None |
| A0A824T7Y0 | 1-70 | None |
| A0A823T1D5 | 1-60 | None |
| A0A698MYT6 | 29-96 | None |
| A0A7I9M200 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.