DPCstruct | MC11199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 497 |
|---|---|
| Mean domain length (aa) | 184 ± 31 aa |
| Standard deviation of domain lengths | 30.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C1PWV5 | 18-190 | YSVLRAGLRTGDLLFASGDYLVSQAIQKVTKSPWSHIGIIFKIEEIDRVLLLESVEDMGVRFVPLSKYTDDYDNGAPYKGRLVVARI… |
| A0A5M4AK63 | 2-150 | GITKVTSDGIYVLNSEPKYGVIRQPLDSFLHPEGERAEVVAYRLKAPFRKSIPEAMKRAHQLIGQPYNYSYILPDTGYYCSEFVYTV… |
| A0A1X7ALQ7 | 320-513 | None |
| A0A067C8B8 | 530-728 | None |
| A0A554V440 | 323-481 | None |
| A0A1Q6TXI1 | 26-175 | None |
| A0A4R2EBV0 | 190-437 | None |
| A0A358SMD7 | 2-188 | None |
| A0A358SLN4 | 11-194 | None |
| A0A7X7A377 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.