DPCstruct | MC11197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 165 ± 12 aa |
| Standard deviation of domain lengths | 12.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2LNP8 | 44-202 | VTNPVFTLQLSPPIGWTYFPVETTNPTAINFFVGQSNDSVTAQNRANNEILASALEAMASINMPVNNIQVTNDYKPISVENPGTGTT… |
| A0A016UV29 | 129-288 | VHGIRNPKFLMVLSPPVSWTFCEPLCGIGDQAVDTDDAKENASEDIKQALVAAFERAHLHVPADSQVVVQYDPKSTMIDEFGEFFDR… |
| H3EU46 | 230-377 | None |
| H3EZI4 | 22-211 | None |
| H3EZI3 | 472-619 | None |
| H3FM22 | 39-203 | None |
| A0A6G0V0X6 | 30-210 | None |
| A0A2A2KZC0 | 108-270 | None |
| A0A4U8V297 | 1-172 | None |
| A0A3P7KYJ7 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.