DPCstruct | MC11195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 123 ± 23 aa |
| Standard deviation of domain lengths | 23.11 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7RN69 | 123-208 | MVEFPTETQDLTPVEAPAAVTESLPEVGVWKEWSRWTPCSKGQRIRVRQCTGKTCEGLNKQSQTCFSTQQATPVANDPMVIEKEIQ |
| A0A2A2LGP7 | 2-93 | EYNDAQDQEQEIALPEPESVVYGQWSVWSAYTPCSNGERTRVRTCLSRKYALKVICHGVSIEVQRCFSSAETHVPVAQDPYSIEKEI… |
| A0A4U5LYG0 | 25-163 | None |
| A0A0R3RZE9 | 10-135 | None |
| A0A0D8Y8X0 | 148-252 | None |
| A0A0D8Y8A5 | 106-268 | None |
| A0A6V7WNM6 | 44-189 | None |
| A0A0M3IDK6 | 235-331 | None |
| A0A0N5CYU3 | 47-204 | None |
| A0A368FD70 | 8-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.