DPCstruct | MC11194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 137 ± 24 aa |
| Standard deviation of domain lengths | 24.15 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0063- CL0335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1FYG3 | 2-95 | HWINERYAAVALLPLIPAALIYPNYVLDTLLTTAMVMHTHWRLSGVAQDYIHGQILPKIARPTVLLITIFAFGSICYFNYTDIGFAN… |
| A0A2A2LE95 | 16-147 | VLANRLSKSGILTNPIRVASTLNDGASKAHDHSMHFKIERIWAAGMVPIIPAAYFIHNPVMDALLTIALTMHIHWGVQGVIADYARP… |
| M4BRN0 | 3-94 | None |
| A0A1B0AHH3 | 9-133 | None |
| A0A1B0BXM3 | 13-147 | None |
| C1E3X1 | 17-108 | None |
| A0A0P1AEG3 | 2-152 | None |
| A0A498N070 | 160-260 | None |
| A0A0G2ETU0 | 50-177 | None |
| A0A1E4RKT4 | 489-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.