DPCstruct | MC11192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 646 ± 142 aa |
| Standard deviation of domain lengths | 142.39 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2L0I6 | 224-1037 | IAQRETVSPDGSTCMQCRSGNCNCNGESEILRNGQCEACQNGTIPDEAGMNCVPCTSMECLCQSDSTSCDSPLNVPNVMDEIELTGR… |
| A0A2U9AYE3 | 2-611 | CVMNMHSFSGVSNDACGLFNSIFRARAAVSSTQDISYWRANLPWLYYGDEPGLASRVLQTDPIPIGFSFRGRNKNTDIKLLAAVYNV… |
| A0BV64 | 47-824 | None |
| A0A3F2Z089 | 57-698 | None |
| A0A2A6B719 | 250-1003 | None |
| A0A3M7RZI8 | 83-803 | None |
| A0A0B2VDQ9 | 1-434 | None |
| A0A5A8CU97 | 13-851 | None |
| A0A2P6MXG7 | 110-836 | None |
| A2FR54 | 80-739 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.