DPCstruct | MC11191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 151 ± 21 aa |
| Standard deviation of domain lengths | 21.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814CJW8 | 6-104 | DLDFQWFGYENSDPHTSSDEEENDDSEPIRAPLQLMTEFVNSIMFRRWTVAKKLCHFVLMYEPDNKEAKQFQPLIDYMLKKEEEKGS… |
| A0A3Q1HD60 | 14-171 | KSAAVSSEELKLKAQPSAVTGRTLASPIAERLPEHEVNEEEEQTDKEDIEDEDLKAPVELIIEFLRAIMDKDFQLASKLCQMILIYE… |
| A0A6P6CA64 | 273-430 | None |
| A6QQ66 | 3-141 | None |
| A0A2A4JUP0 | 65-232 | None |
| A0A6P8RGE8 | 168-316 | None |
| A0A4Z2H9J4 | 4-115 | None |
| A0A834F3T0 | 2-138 | None |
| A0A6J3BQT2 | 194-356 | None |
| A0A7N9CFU4 | 344-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.