DPCstruct | MC11189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 138 ± 25 aa |
| Standard deviation of domain lengths | 25.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.67 |
| Pfam Score | 45.45 |
| Assigned Pfam label(s) | CL0123- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9UW56 | 2-120 | AWLKGGVISHRIIINDAKARVHTVDSTAFLVSPDIFKRYALEHPAIEHEAKERDLEAWQLVQRSFEKLKKHRKTPAGLNIWTCLVKG… |
| A0A7V5JGY6 | 7-121 | AHAGQDFLNWLRTGLHERRFAVNEVNARIHMTKEGLLLVSPAIFKEYDKKRWSYVQKRFTKLKLHARNANGTNIHEYVASGSKKRSI… |
| A0A7X7AL81 | 17-151 | None |
| A0A3N8C265 | 253-390 | None |
| A0A3M3Y2P1 | 323-489 | None |
| A0A661PI06 | 107-226 | None |
| A0A8B5X8B4 | 17-172 | None |
| A0A263HFA5 | 6-114 | None |
| A0A849SSJ8 | 387-573 | None |
| A0A827YNL9 | 103-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.