DPCstruct | MC11187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 34.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1U4E2 | 12-150 | LLAAGLASLGLPLAVQAEVPLPKVPEAQKRVSETQGCVEPVEVMRKKHYEFLKHQRDDTLRRGIRTRKYSLEECINCHVPPPESGKL… |
| A0A3B1CJR0 | 8-112 | IASVLFLIILAFPLYYNVFAGAPPAPEIKVDKPGKCIAETSWMRSNHMKMLMHTRDNVVREGFRETNHGIQGCRSCHEKRSEFCDKC… |
| W0SDD2 | 38-164 | None |
| A0A661DL84 | 32-156 | None |
| F8AAJ0 | 1-123 | None |
| W0DJS3 | 15-137 | None |
| A0A0S8CS13 | 5-125 | None |
| A7BPV9 | 22-139 | None |
| A0A3B0YKX0 | 16-150 | None |
| A0A1E5Q9M9 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.