DPCstruct | MC11186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 51.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8AWQ4 | 5-61 | VSRSEFQAIFAETAGAGQAGPQEAFVIYKPANQILWALNDGEAQSPITLRIGTVDYD |
| A0A6B2NY15 | 1-73 | MLLFGNASASRDQFQVDLAHTRNAEGERAGDKDVQEAFVIYRPTGQIMWALVDGEEQSSINPQIGAGIVDHLI |
| A0A1H8ALB3 | 35-96 | None |
| A0A0P1FS48 | 212-275 | None |
| A0A2R8AQD1 | 569-632 | None |
| A0A1M4SBF4 | 814-878 | None |
| A0A2G1CB10 | 1-83 | None |
| A0A428JS07 | 23-86 | None |
| A0A347UKW2 | 399-462 | None |
| A0A2G1CBM3 | 1104-1172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.