DPCstruct | MC11183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4X219 | 66-127 | EVVDGILICGKCLRWYPIIDEIPRMLPDDLRKADDDISFLKRFSDRVPKEVLESGVPYNLKS |
| A0A7C1YYI4 | 27-83 | SGLLFCKNCKRWYPIIDTIPQMLPDEYRNEEEEISFLENNRNLLDKEFFNQELKPFN |
| A0A497K4P5 | 1-60 | None |
| A0A497MWW7 | 30-91 | None |
| T0NFQ8 | 17-79 | None |
| A0A7C4DAK2 | 150-198 | None |
| B8D369 | 27-90 | None |
| A0A7J3I2K4 | 50-100 | None |
| A0A850M073 | 147-210 | None |
| A0A1Q9NC07 | 31-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.