DPCstruct | MC11182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 134 ± 18 aa |
| Standard deviation of domain lengths | 17.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8WG64 | 2-99 | DRFFAYVEFVEENPLYEDKIFKTTNGIVRATLRKDRPMTIASFCIFLGVTTQAWRYWRKNRDDLAEAIELIEDATFVYKFERAAVGI… |
| A0A7C1W170 | 5-137 | IHNKVGRPPKYDSPEELQEKILDYFKECPDTKTTYFKLKDEVIEKVIPCLTISGLMLYLGFDSRQSFYAYEKKPEFSYTIKKARTFI… |
| A0A3G6TE58 | 1-132 | None |
| A0A6M3J6L7 | 29-194 | None |
| A0A6M3KDB3 | 4-117 | None |
| A0A0F9JWT2 | 2-137 | None |
| A0A7L7LBD9 | 8-136 | None |
| A0A3C1BIJ3 | 1-113 | None |
| A0A2D9WNV7 | 34-174 | None |
| J0N415 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.