DPCstruct | MC11180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 10.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S3KKT6 | 1-95 | MSRLRAAEYLGVSVRTIRHWDAGRNRVPWSAVRLLRLVRSGQLGGLFEEWEGWTINRLGLHSPDGRTFRERDMRQLWLTVTQAALFR… |
| A0A7C1VQY4 | 8-103 | DQHPALYGIQAEWISEVCQVHITTARRWKRGEDPPYSATQLVEMLSTGNMGIVDKDWTGWALRQGLLIAPNGDRFSPGEVMSMTYWR… |
| A0A5C9BKY8 | 8-114 | None |
| A0A1I6BZM3 | 1-112 | None |
| A0A6P1IJV0 | 9-121 | None |
| A0A5A7VV82 | 23-134 | None |
| A0A7U6JI40 | 13-139 | None |
| B9MJI7 | 2-108 | None |
| A0A7T2S5G3 | 1-81 | None |
| A0A1T2L592 | 16-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.