DPCstruct | MC11177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 209 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 13.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6BT53 | 84-289 | YESIHRRIAGKGGLDKAIYAEFAGAWNAVTHRFKALVTHDDLFTASISKHGTAPPAEERHNQERDLFGFFNSGFSMFEAFFYALHAA… |
| A0A7C1VHZ0 | 8-213 | ELRKLCKEKGIPDSTLYQNSLGWRWKRTDFHADKANEVWAELFMKSFTFVDQRCYEAIFSYEAHVESCVQSLHSMADILAQIINVII… |
| A0A8A5Z5J2 | 26-208 | None |
| A0A164QF00 | 41-243 | None |
| A0A6M6E311 | 12-203 | None |
| A0A1Z4KD60 | 9-247 | None |
| A0A4Q3F9V9 | 58-238 | None |
| U5F8H4 | 191-404 | None |
| A0A6M6E8F3 | 16-226 | None |
| A0A844KSX3 | 18-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.