DPCstruct | MC11175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 123 ± 20 aa |
| Standard deviation of domain lengths | 19.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3D6V0 | 1-80 | MARGTYTPSFDGFLLIFHPDDVPNMAPHPDRHRLSGCCGPAGQDGPNLVCANCGGEVATKEADCWTDNLVAVISAAVVEQ |
| A0A4P7IHJ4 | 4-135 | QVFRCAVCDRALTRSMTQLPTLPVAKPVDEVSYEPTLEVGTWAIDPGPRLLTADGAPAGTLGCLVTNPLDAPDLEPHPEPRRNSGCC… |
| A0A0M8W3K1 | 2-111 | None |
| A0A318BJE2 | 5-105 | None |
| A0A6A0B2Z1 | 2-116 | None |
| A0A1I1SFL3 | 2-138 | None |
| A0A511YP85 | 3-90 | None |
| A0A1A9C1Q2 | 1-140 | None |
| A0A142XC98 | 7-133 | None |
| A0A1D7Y8M8 | 3-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.