DPCstruct | MC11174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 110 ± 23 aa |
| Standard deviation of domain lengths | 22.51 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R9SZ21 | 1-102 | MKLLYMYVESQGDIFRDIFFNFSSEYIVEYDKAYNKILIKNNPKYFKNFYGKSISDITAIVGKNGSGKSLILEIVGREMRERIELLK… |
| A0A0B5QPB6 | 1-103 | MELLYICIDDYRNFKETEIHLSDKFKFCYSQEDLTLTCNEGMNSSFGFLDEYITNLSVIVGDNGAGKTTILKCIMEHLTYKGLEITS… |
| A0A412HTV7 | 1-137 | None |
| A0A413IQJ2 | 1-75 | None |
| A0A6S6RU57 | 1-95 | None |
| A0A2G7M5V3 | 4-104 | None |
| A0A2Z5U3H6 | 1-107 | None |
| A0A4Q1EYW3 | 1-123 | None |
| A0A841U066 | 1-108 | None |
| A0A7U2XIZ9 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.