DPCstruct | MC11172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 201 ± 27 aa |
| Standard deviation of domain lengths | 26.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9X5T8 | 118-329 | GSVESKAGDVTLNALGILTIQGSQVENNVNPDAIGQGGDINIQAGSIFLTNGAQLSTNTYGKGNAGNIVIKASDSVTAATNSLILSN… |
| A0A1Z4J829 | 8-193 | ELSSSSQGNGAAGNLTVNANLIRLDQQGKISAETIARQGNINLNLRDLLVMRRGSEITTKASGNNITGGNIKIDGKNSFVVAVKNEN… |
| A0A3D4XTB6 | 162-369 | None |
| A0A0F2J2R2 | 3-198 | None |
| A0A2N9YHB4 | 705-918 | None |
| A0A6M0F232 | 2-173 | None |
| A0A1V1P182 | 18-207 | None |
| A0A5P8WF60 | 18-179 | None |
| A0A5P8WGV4 | 9-222 | None |
| A0A844MV18 | 7-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.