DPCstruct | MC11170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3KD17 | 3-95 | SALQVSRRYRGFVLTHQGMEKLQERIQQLEMRTRIRQSPGMIAQRVQLTQPDGIHPMTVRKLLRRQKGVDKRSILCVFEALQIQLEE… |
| A0A1Z4J583 | 1-85 | MQLQKTRRYRGVILTTQGWGKFQAAKTQAEFNENAGDRFTLEELSERMGLSLNTIAKVLGRTEPVDKQSLQWAFRAFGLELSKND |
| A0A433VFP3 | 1-95 | None |
| A0A7S6M1J2 | 1-83 | None |
| A0A0X8WX96 | 1-73 | None |
| S3JVF7 | 2-86 | None |
| A0A661CUL4 | 4-88 | None |
| A0A846FF86 | 3-97 | None |
| A0A1Z4SBL3 | 1-97 | None |
| A0A2T1DVH0 | 17-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.