DPCstruct | MC1117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 10.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 28.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6EY07 | 2-96 | FTLLYSINLVLGLRALATDKAHFLAWVATQSHPLMILFAIASFLMVGYHCYTWFDATPKVMPLQIKDKKVPAKFIVLGHWGAAVFLA… |
| A0A447THR4 | 3-109 | EEPYFIEYMIHEGTALFVAAYGFVLLFGLWRLSQGEAAWNGFVAALRSPLSMLLHLILLAMIGYHGYTWFKIMPRTLPPLIISGRRV… |
| A0A7C2NFB8 | 29-143 | None |
| A0A2E5YKT7 | 54-181 | None |
| A0A2D8R6G4 | 1-116 | None |
| A0A2W6AJY0 | 31-155 | None |
| A0A651HEU3 | 151-276 | None |
| A0A0H5BG10 | 11-134 | None |
| A0A1G3HWN6 | 11-126 | None |
| A0A3P1XLE2 | 100-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.