DPCstruct | MC11169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02576 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9SKQ2 | 241-353 | PFVGDGAGGGGISLAGTAWDKKALEIAEEVIISFDGELGIYAFKTLLNAAIQVRIERLTNKSGSPSMTDIEAFSTTYRARLDEAEAT… |
| A0A0M5JFD1 | 1-94 | VGDGGAGGGVSLAGTWWGKEALALAEEVSASFDGDLKIYAFKATANLEIRVRIEKMSTYGSPTIDDIEAYTIAYRAKLDDAESGGRI… |
| A0A565B1M6 | 49-149 | None |
| A0A2V0PDW8 | 155-265 | None |
| A0A287II72 | 84-200 | None |
| A0A6A2WXD2 | 129-244 | None |
| D8TJS4 | 238-347 | None |
| M5VV18 | 52-148 | None |
| A0A2P6V3W5 | 883-1001 | None |
| A0A5N6R340 | 222-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.