DPCstruct | MC11165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 268 ± 41 aa |
| Standard deviation of domain lengths | 41.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.80 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0040- CL0458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2RNI9 | 1-329 | PLPASYPVCCIVASGNGMDSASLADRMVVAAHLWSHGISAEYVPQSGVMMSLLRKQNSESNKFDSSSSDWTLEHICGICAVLKIPYV… |
| L8X4J9 | 1-313 | MDRIASALADYLSSSVKSMVKEERSFGYWSPSRCDVYIASFQPGLLHERVELLRDLWSHRIRTDTMYEEATQQSGDDRMAHFALRFL… |
| A0A0K0E9D6 | 24-322 | None |
| A0A821MY86 | 168-434 | None |
| R1GP17 | 2-222 | None |
| A0A7S0UEZ0 | 257-604 | None |
| A0A0N5B0K5 | 569-823 | None |
| A0A1B6MFB4 | 56-300 | None |
| A0A820RY90 | 360-626 | None |
| D0Z5N4 | 1409-1698 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.