DPCstruct | MC11164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4FYJ1 | 330-424 | GRIQWSKLQVFDCRYVTTTSGMFEAICNHIKYATNKGNLRSAITIFPQRTDAKHDYRIWNSQLISYAGYKQADGKIIGDPMNAEFTE… |
| L8X019 | 1-97 | MRSQWSTMNTIDCRDVTTGEEMIEACLRHIEIANNGGRVKPTTTIFPQRFPGKESARIWNAQLMRYAGYKMPDGSILAKVWEVRCSP… |
| R7UNF1 | 81-177 | None |
| A0A250VIJ3 | 76-174 | None |
| A0A1L7XJ12 | 108-189 | None |
| A0A380H191 | 64-152 | None |
| S4RJ43 | 119-215 | None |
| A0A0B7F815 | 153-255 | None |
| A0A6J1WAE9 | 129-214 | None |
| A0A810M6E2 | 82-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.