DPCstruct | MC11163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 135 |
|---|---|
| Mean domain length (aa) | 406 ± 98 aa |
| Standard deviation of domain lengths | 97.58 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8NH74 | 53-310 | VLEELNPTDFSLVREDVEAQLLNMTERRQRSMNEHYYRRRRIEVEQHFNRLKSEGNFVLPTLAEFRKLPVMQLVQGKVGTSNNSFAG… |
| L8WYT4 | 61-539 | HRTLKDPQQQHIWKNARICFPHFPIPAPVRISEIRVASLLFDDTTCSRDGKTYAKAWQKKTICRKSDIDMVMKDIDAGMEKAELQVK… |
| A0A0K6FR47 | 45-447 | None |
| A0A0K6FZV9 | 63-418 | None |
| A0A0K6G3B0 | 37-685 | None |
| A0A397TYR9 | 37-495 | None |
| A0A397U6F8 | 317-794 | None |
| A0A4Q2CZ48 | 37-396 | None |
| A0A4Q2DK03 | 5-339 | None |
| A0A4Q2DBA8 | 43-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.