DPCstruct | MC11161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 187 ± 35 aa |
| Standard deviation of domain lengths | 35.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.58 |
| Pfam Score | 78.68 |
| Assigned Pfam label(s) | CL0258- PF19302- CL0111- CL0298 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800M936 | 253-443 | LDQFSTMQRDVTAAYERFEYHVVYQRISQFVSVELSAIYHDCIKDRLYAESANAPSRRAAQTTLHRLCAALTRMLAPICVFTAEEAW… |
| L8WRC4 | 40-220 | LHPFMPFVTEELWQRLPRRPGDDSAFENAAADKDFDKVFGIIKQSRSLAAQYNVQSNIQVFISSTSAEEAAMITTQTPTISSLIKGC… |
| A0A7S3ZYJ7 | 235-429 | None |
| A0A0G1RRC8 | 2-130 | None |
| A0A183M642 | 100-365 | None |
| A0A1S8VHA1 | 17-200 | None |
| A0A850KKR7 | 193-382 | None |
| A0A7X7BQT0 | 7-172 | None |
| A0A521TZA9 | 736-938 | None |
| A0A7C2CZH6 | 7-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.