DPCstruct | MC11153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 142 ± 18 aa |
| Standard deviation of domain lengths | 17.51 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9PTT6 | 8-115 | LVHHFADDAYDGAADAREALGPGAQWIPADAADIRTRTSTRKDPDAVVQFASGSALDPELCTPGPRMSGAAWAFDDSPDVYAVTDAY… |
| A0A3L7AD95 | 1-134 | MTLAGAALALTVTVSGCAGIDELVTRTKAASYQDRDALISSGIAASWVPRDAHRIRASRSLDGADMSVLITSKSGLDPRKCPRVARK… |
| A9WUK2 | 18-158 | None |
| E6WUG0 | 87-250 | None |
| A0A7W9JZD5 | 1-155 | None |
| A0A0M0F5Y2 | 24-180 | None |
| A0A2W1UC62 | 4-129 | None |
| A0A1H4CCY7 | 7-139 | None |
| A6W9L6 | 176-321 | None |
| A0A506XS60 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.