DPCstruct | MC1115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 234 ± 46 aa |
| Standard deviation of domain lengths | 46.49 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02119 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7MW59 | 359-607 | IGIGLVYGLNGTGDSMKDSTVAAQPYAQLLKNLGNISLDLRSLGKTRSIALVFVSVEIPRTGARTDDRLDVTIGTLGTATNLEGGQL… |
| A0A3S4LJE4 | 2-234 | VGLDGSGDKVTSSPFTGQAMINMLNQLGVQVPPGTKIDPKNVAAVTLTATLPPFSKRGQMLDVTASSIGDAKSLRGGTLLLSPLKGA… |
| A0A3M1DX48 | 160-530 | None |
| A0A377E6W9 | 23-237 | None |
| A0A7Y5N149 | 75-362 | None |
| A0A2D5P7S2 | 40-260 | None |
| A0A800AR94 | 37-207 | None |
| A0A2D5Z1A2 | 173-394 | None |
| A0A1A9Z125 | 593-869 | None |
| A0A2X4URR6 | 44-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.