DPCstruct | MC11149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7VE24 | 3-126 | NTKTIELEKVIVEATKRLDIEMFKEFSVHVEDFKNNKKQYFINDLETAFKKFRQSGDTFLEPEFGKYCLCNKNCVRYLFIGNKSRNY… |
| A0A328YVZ1 | 13-127 | LIEQFILASENIDTLKIEELLDEDGAYEIEDETLEVNETSKPEFLKWYTTKLKTTKITDVIYDQCIGCSFGKNIVILNHGTFPIIPQ… |
| A0A5C7F238 | 2-99 | None |
| A0A1M3ECZ9 | 5-109 | None |
| A0A5C6RXV3 | 19-122 | None |
| A0A4V2NQR0 | 15-122 | None |
| A0A838TFC7 | 10-129 | None |
| A0A7D5MF26 | 7-121 | None |
| A0A4P6YC01 | 1-101 | None |
| A0A167ZL28 | 33-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.