DPCstruct | MC11143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 170 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A175WCR2 | 101-252 | AAPLVTVSKSTFATSVYRLFRACLRACPTTKDMAINFVQAGQLRLQLFFSEAERLFLVHDRWLSVDGAIMELGLPDGLMEADIIFHT… |
| A0A7H8R6P1 | 6-180 | NVAECKVPETPYAKNIERGLKATLALWNETNEMKMRFVSSENDDIDMAVDRKEGTLNVHQRWLKYEEMHQKHRCRELVLSDCFVCDH… |
| A0A2P2GWY9 | 394-556 | None |
| A0A2V5IQM4 | 462-619 | None |
| A0A6A5UDA5 | 419-576 | None |
| Q2U1J9 | 9-141 | None |
| A0A395HH48 | 4-168 | None |
| A0A1V6VPU9 | 26-173 | None |
| W9W285 | 2-165 | None |
| A0A6A5VPX7 | 185-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.