DPCstruct | MC11141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 199 ± 19 aa |
| Standard deviation of domain lengths | 18.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8S7V3 | 1-168 | MAPKPTSAPPAPSRSSAPLPGPATTRVSSQHERLLLELLPFKEATKFHDWLTSNFVRGSWDEFHTDYLSRLGPVAEPEPDKNRTAQA… |
| A0A7H8QT94 | 20-203 | NSRLGDRVADKPTRQSAPKTKSGLQKVLRLTSDESWKQWLQSRLVKPWWTELWNDCLKTREKGIRSVGLAEVQERMLSGEANGIMKY… |
| A0A1L9VN09 | 12-225 | None |
| A0A1B8FU60 | 108-325 | None |
| A0A093YHS5 | 4-196 | None |
| A0A094IUF4 | 40-246 | None |
| J3P4T0 | 31-243 | None |
| A0A3D8SXV4 | 154-325 | None |
| E4UPG0 | 21-216 | None |
| A0A178E518 | 7-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.