DPCstruct | MC1114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 168 ± 34 aa |
| Standard deviation of domain lengths | 34.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05861 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376X6C5 | 202-392 | GREGDRRRHALQESRRRGDTDLPELSVAQIEQQLNLAVDRVMTEGGIADRELAALALKQASGDNVEAIFLLRAYRTTLAKLAVSEPL… |
| A0A3S4LJB3 | 27-163 | EAVPELSIAQIRQQLRLAVARVMQEGSLYDEELAALALKQASGDSIEAVFLLRAFRTTLPRFGQTRPLNTAAMRVRRRVSGTFKDVP… |
| A0A3M3P0P6 | 1-100 | None |
| A0A2A3VTK0 | 1-179 | None |
| A0A0N8KLX8 | 2-209 | None |
| A0A2X1J9S6 | 2-164 | None |
| A0A1S6RZC7 | 1-172 | None |
| A0A418W9G5 | 1-202 | None |
| A0A2X4UBU4 | 29-199 | None |
| A0A4R1X4M6 | 1-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.