DPCstruct | MC11139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 254 ± 26 aa |
| Standard deviation of domain lengths | 26.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225AKQ1 | 6-242 | LLILLFGIAQTSAYSVPGGYERVLIYYMYSIDCQLNGGTPKKIATGCKGTGRNPCTLDQLLRYIAANPSSLPTRSAPATSYPALPDM… |
| A0A7H8QNL8 | 2-232 | LLCYAYRLDIAAGGTFIAPDCPGTGKDKRCYFDEFLRYIEEVEERSPWSGSTSVGKNLAPNVLSTAEELVTTGYSNAVDPGVLYETP… |
| A0A1Q5T6L1 | 55-312 | None |
| A0A162ICW7 | 1-260 | None |
| A0A1M3TTW0 | 8-273 | None |
| A0A1M3TME6 | 18-238 | None |
| A0A366PHP6 | 2-271 | None |
| A0A3D8Q4Z2 | 17-269 | None |
| A0A0P7BL46 | 4-255 | None |
| A0A178EPR3 | 1-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.