DPCstruct | MC11138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 206 ± 38 aa |
| Standard deviation of domain lengths | 37.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0IEQ3 | 163-329 | SASNCGVSRQRSLIQRYPGDMSHRPLDILRKEARAADRAPHLRRKQMPMADTIDALDTIGGMYHHGGPYDATLASRNRNKMYSPVAA… |
| A0A7H8QKE1 | 52-213 | RQQQNVQRRKTQAHRHGGGGSSRYRKNRVNPDIIDQLDNASILQYHHEGPYDAVYPERNVYSQRSPLEAVKDSNEEALRATPMYKIM… |
| A0A2V5IGN8 | 209-440 | None |
| A0A0U5CEM5 | 96-332 | None |
| A0A2B7Y4G2 | 14-194 | None |
| A0A0F2LV96 | 372-649 | None |
| A0A179GL12 | 279-503 | None |
| A0A369GNC6 | 190-432 | None |
| C9SR08 | 18-174 | None |
| A0A6A6GGW8 | 72-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.