DPCstruct | MC11136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 135 ± 20 aa |
| Standard deviation of domain lengths | 20.19 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2JGI8 | 164-318 | CTQRRSALRHVKEERARDFEYCLPYFCNPFKEDELEQSSEVQLIFPSEPPVHCEFDWKFDRLEEFVDNLIEGEEISAEQKDEFKDFV… |
| A0A6I9S8S2 | 1-108 | MFPLEPPVVCDFDWELDDLEEFTDELIEEEALPNDQKDAFKEYVKEQVREQKREQRLAKEARKKAIEDMAPEMRAAFENMLFYKFYP… |
| A0A811MV88 | 177-332 | None |
| A0A6V7PBE6 | 503-630 | None |
| A0A2U1N7U7 | 122-261 | None |
| A0A4S4E5B8 | 293-439 | None |
| A0A3L6P9R2 | 11-102 | None |
| A0A7J0F7G1 | 25-149 | None |
| A0A6A3ARF9 | 126-233 | None |
| A0A5N6PQT2 | 222-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.