DPCstruct | MC11135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 89 ± 3 aa |
| Standard deviation of domain lengths | 3.24 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 67.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816NJT0 | 418-505 | RYGHMIDNVVLIVTGTLHERDVQELIEKCHPLGMFDSIATLAVAQNMRELYRLVLVDTPLAPYFSECLTSEDLDDMNIEIMRNTLYKA |
| A0A6L2MCM2 | 1-86 | MIDNVVLIVTGTLHERDVQELLEKCHPLGMFDSIAILAVAQNMRELYRLVLVDTPLAPYFSECITSEDLDDMNIEIMRNTLLQGIS |
| A0A6I9PG11 | 3-102 | None |
| A0A448WY66 | 99-195 | None |
| A0A4V4MHT4 | 61-148 | None |
| A0A821G0D9 | 91-178 | None |
| S9W718 | 123-207 | None |
| B7P918 | 269-355 | None |
| A0A2Y9P9V5 | 101-193 | None |
| A0A3Q0J3J0 | 17-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.