DPCstruct | MC11133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 59 ± 9 aa |
| Standard deviation of domain lengths | 9.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 72.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16851 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7HCG5 | 90-150 | IISSEGKMKRNSRRLMIGSTAPTCTYNECRGCKYKCRAEQVPVEGNDPINSAYHYKCVCHR |
| Q9SV72 | 49-102 | LLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR |
| A0A5P1F302 | 148-198 | None |
| A0A4D9BYN1 | 41-94 | None |
| A0A833R996 | 63-122 | None |
| A0A7J7N4X3 | 35-88 | None |
| A0A2U1M3Y9 | 28-104 | None |
| A0A1D6PY75 | 1-77 | None |
| A0A830C598 | 2-54 | None |
| A0A438DG28 | 51-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.