DPCstruct | MC11132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 70.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8XJN7 | 1-104 | MHKFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQII… |
| A0A812PQ39 | 28-130 | NWFVDDTNVYRVKIHKAVDGSLKTERINGAIFFFNPRTGQLFLKIIPASVWAGHEPQRLSQLAKQKTAEEVAAWIRSLPAEEHPKQI… |
| A0A0B1SWK9 | 55-156 | None |
| A0A804QI56 | 2-80 | None |
| A0A0K9RHG5 | 36-132 | None |
| A0A815CLG1 | 43-133 | None |
| A0A819ZFU9 | 47-137 | None |
| A0A2J7REU4 | 2-96 | None |
| A0A3L6DH65 | 1-85 | None |
| A0A251N8E2 | 41-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.