DPCstruct | MC11130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 220 ± 26 aa |
| Standard deviation of domain lengths | 25.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01086 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3C5W4 | 2-177 | RAGMLGFKFVQVQAECDYIRRKKKEDKEMLQHIMAEEFKIEFYRKRLIAVENNKTSNTEKENLFLANREKFHAEAEKNYWKAIAELI… |
| A0A5C7GZE3 | 1-208 | MSTLTDSVDSSFNDDAADHVFLSYHSIYATGSDGPITEWTRENAIRLEKKEKKERALLSQIIEQAHEYKDEFYRKRVVSCHNNKDTN… |
| A0A0K9RCR1 | 42-259 | None |
| A0A2P6RTR4 | 68-317 | None |
| A0A4D9B4H0 | 44-257 | None |
| A0A371HJN8 | 55-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.