DPCstruct | MC1113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3IV90 | 2-105 | LVGVSALAFLGLAYWQFQRFESVTGDGQNLGYALQWPLFAAFVIWAYRRFVQYEDEGPPPPPSDRVTEIPEGLLPERPAAAKPDPAD… |
| S5TLN1 | 49-176 | EKFQIKAWHIILLVVAVLACLGLAYWQWTRFQAGSGTFQNLGYAFQWPLFAVFFIYAYRMGVKYENEARHAKNEADDDDFLYEADLE… |
| C4LJY2 | 17-159 | None |
| A0A2N3V7C2 | 5-124 | None |
| C8XEW1 | 7-160 | None |
| A0A1H0D409 | 32-152 | None |
| A0A1F2EV84 | 2-94 | None |
| A0A0G3IS46 | 6-120 | None |
| H5U4R9 | 2-115 | None |
| A0A1V2P5T8 | 5-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.